PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014443m
Common NameCARUB_v10014443mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 259aa    MW: 29013.7 Da    PI: 8.1405
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014443mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-162976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEde+lv  +++ G g+W++ +++ g+ R++k+c++rw +yl
  Carubv10014443m 29 RGPWTVEEDEILVSFINKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 76
                     89******************************99************97 PP

2Myb_DNA-binding48.52e-1586127548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Carubv10014443m  86 TSDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 127
                      99****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-212079IPR009057Homeodomain-like
PROSITE profilePS5129415.1642476IPR017930Myb domain
SuperFamilySSF466894.87E-2926123IPR009057Homeodomain-like
SMARTSM007173.0E-132878IPR001005SANT/Myb domain
PfamPF002498.1E-152976IPR001005SANT/Myb domain
CDDcd001672.91E-113176No hitNo description
PROSITE profilePS5129423.57877131IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-2480131IPR009057Homeodomain-like
SMARTSM007173.9E-1481129IPR001005SANT/Myb domain
PfamPF002496.2E-1486127IPR001005SANT/Myb domain
CDDcd001677.83E-1286127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MMRSSSRGGK KPVLSKKTTP CCTKTGMKRG PWTVEEDEIL VSFINKEGEG RWRSLPKRAG  60
LLRCGKSCRL RWMNYLRPSV KHGGITSDEE DLILRLHRLL GNRWSLIAGR IPGRTDNEIK  120
NYWNTHLRKK LLRQGIDPQT HKPLDVNHIH YKPEEEVSGG QNPLDPNSSS HTDTTVDSGD  180
GATKKSISVF GGEGNYDDFG FCYDDKFSSF LNSLINDDDD PFGNIIPILS QPLQMDDCKD  240
DIVGASSSLG HNQRKEDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26291314105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-262713125128MYB TRANSFORMING PROTEIN
1mse_C2e-26291314105C-Myb DNA-Binding Domain
1msf_C2e-26291314105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195870.0AY519587.1 Arabidopsis thaliana MYB transcription factor (At3g13540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298373.10.0hypothetical protein CARUB_v10014443mg
SwissprotQ388501e-153MYB5_ARATH; Transcription repressor MYB5
TrEMBLR0G7270.0R0G727_9BRAS; Uncharacterized protein
STRINGscaffold_301556.11e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-155myb domain protein 5